DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and OVCH2

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:283 Identity:98/283 - (34%)
Similarity:152/283 - (53%) Gaps:37/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PGCGE---------VYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAA 359
            |.||:         .:...:||:||.....||:||||:|.:    .:|..|||:::|.:||||||
Human    35 PSCGQSLVKVQPWNYFNIFSRILGGSQVEKGSYPWQVSLKQ----RQKHICGGSIVSPQWVITAA 95

  Fly   360 HCVASTPN--SNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYN---PADFVNDVALIRLDRN 419
            ||:|:. |  |.:.:..||:|:...:.  ..:...||...:|||::   |.|:  |:||:::...
Human    96 HCIANR-NIVSTLNVTAGEYDLSQTDP--GEQTLTIETVIIHPHFSTKKPMDY--DIALLKMAGA 155

  Fly   420 VVYKQHIIPVCLPPSTTKL-TGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAG 483
            ..:...:.|:|||....:. .|.:.|.|||||...| ..:..|||||::.:::.:.|....... 
Human   156 FQFGHFVGPICLPELREQFEAGFICTTAGWGRLTEG-GVLSQVLQEVNLPILTWEECVAALLTL- 218

  Fly   484 RREAIHDVFLCAGYKDGGRDSCQGDSGGPLTL-TMDGRKTLIGLVSWGIGCGR----------EH 537
            :|......|||.|:.|||||:|||||||.|.. ...|..||.|:.|||:||||          :.
Human   219 KRPISGKTFLCTGFPDGGRDACQGDSGGSLMCRNKKGAWTLAGVTSWGLGCGRGWRNNVRKSDQG 283

  Fly   538 LPGVYTNIQRFVPWINKVMANDN 560
            .||::|:|.:.:|||::.:...|
Human   284 SPGIFTDISKVLPWIHEHIQTGN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 92/253 (36%)
Tryp_SPc 316..555 CDD:238113 93/255 (36%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 92/253 (36%)
Tryp_SPc 56..301 CDD:238113 93/255 (36%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426785at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.