DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and CG3117

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:334 Identity:90/334 - (26%)
Similarity:147/334 - (44%) Gaps:69/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 FFD-------------AESQAPLDSAGAPPPHEPLPNAQAFAVGNVLDLNAGEAADEYQSGGSGG 294
            |||             .|....:..:.:||.|         :|..:|..:...|.|         
  Fly    42 FFDFSSTIECSDEEVCCEKSNVIGMSKSPPQH---------SVDTLLRTSYPNALD--------- 88

  Fly   295 YHDASYRPVPGCGEVYTRSNRIVGGHSTGFGSHPWQVALI-KSGFLTRKLSCGGALISNRWVITA 358
                      |..:|:        |..|.....||..||. |..:|.     ||:||:...|:||
  Fly    89 ----------GSPQVF--------GDQTKPNQFPWVTALFAKGSYLG-----GGSLITPGLVLTA 130

  Fly   359 AHCVASTPNSNMKIRLGEWDVRGQEERLNHEEYGIERKEV----HPHYNPADFVNDVALIRLDRN 419
            ||.:|....:::.:|.||||: ...|:||..   ::|:.:    |..:|.:...||:||:.||..
  Fly   131 AHILAGLSPNDIMVRAGEWDL-SSSEKLNPP---MDRQVIKIMEHEAFNYSSGANDLALLFLDSP 191

  Fly   420 VVYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAA-- 482
            ...:.:|..:.||........::.||||||........:.::.|:||:.|:.:.:|||..|..  
  Fly   192 FELRANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKM 256

  Fly   483 GRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMD---GRKTLIGLVSWGIGCGREHLPGVYTN 544
            |....:....:|||.:: |||.|....|..|..::|   .|....|:||:|:|||:.::|..:|:
  Fly   257 GSNYQLPASLMCAGGEE-GRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTH 320

  Fly   545 IQRFVPWIN 553
            :.:|:.|||
  Fly   321 VSKFMEWIN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 74/246 (30%)
Tryp_SPc 316..555 CDD:238113 77/248 (31%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 75/243 (31%)
Tryp_SPc 95..328 CDD:214473 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.