DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and CG18557

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:239 Identity:77/239 - (32%)
Similarity:115/239 - (48%) Gaps:15/239 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 PWQVALIKS--GFLTRKLSCGGALISNRWVITAAHCVASTPNSNMKIRLGEWDVRGQEERLNHEE 390
            ||.|||:::  .|..     .|.|::...||||||.:.....::..|..|.||:: |......:.
  Fly    96 PWTVALMQNLINFFG-----AGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLK-QLAGKTIQW 154

  Fly   391 YGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQ 455
            ....|...||.:|.....|::|||.|:.:.|.|..|.|:|.|.|......:...||||||.....
  Fly   155 RTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLA 219

  Fly   456 STVPSVLQEVDVEVISNDRCQRWFRAAGRREA--IHDVFLCAGYKDGGRDSCQGDSGGPLTLTMD 518
            .......:::|:.::|...|:...|.....::  :....|||| .:.|||:|.||.|.||...:.
  Fly   220 KNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG-GERGRDACIGDGGSPLMCPIP 283

  Fly   519 GRKT---LIGLVSWGIGCGREHLPGVYTNIQRFVPWINKVMAND 559
            |...   |:|:|:.|..||.|::|.:||||....|||.|.: ||
  Fly   284 GHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQL-ND 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 72/230 (31%)
Tryp_SPc 316..555 CDD:238113 74/233 (32%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 74/233 (32%)
Tryp_SPc 90..320 CDD:214473 72/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.