DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and Ser6

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:260 Identity:81/260 - (31%)
Similarity:120/260 - (46%) Gaps:51/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 SNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVAS-------TP--NS 368
            :.|:|||........|.||:|..:|    ..||||::::..:::||||||::       ||  ..
  Fly    29 NGRVVGGEDAVKNQFPHQVSLRNAG----SHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAE 89

  Fly   369 NMKIRLGEWD-----VRGQ-EERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHII 427
            ...||.|..|     |..| .|.:.|||||             :|:|||||:||:..::....|.
  Fly    90 RFTIRAGSNDRFSGGVLVQVAEVIVHEEYG-------------NFLNDVALLRLESPLILSASIQ 141

  Fly   428 PVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRW--FRAAGRREAIHD 490
            |:.||...|.....: .::||||.:| |..:|..||...::.|:..:|:..  |...|....:|.
  Fly   142 PIDLPTVDTPADVDV-VISGWGRIKH-QGDLPRYLQYNTLKSITRQQCEELIDFGFEGELCLLHQ 204

  Fly   491 VFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGI-GCGREHLPGVYTNIQRFVPWINK 554
            |       |.|  :|.||||||...    ...|:|:..:.: |||..: |..|..:..|..||.|
  Fly   205 V-------DNG--ACNGDSGGPAVY----NNQLVGVAGFVVDGCGSTY-PDGYARVFYFKDWIKK 255

  Fly   555  554
              Fly   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 78/254 (31%)
Tryp_SPc 316..555 CDD:238113 80/257 (31%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 78/254 (31%)
Tryp_SPc 32..256 CDD:238113 80/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.