DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and LOC3291433

DIOPT Version :10

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_061514351.1 Gene:LOC3291433 / 3291433 VectorBaseID:AGAMI1_009341 Length:395 Species:Anopheles gambiae


Alignment Length:100 Identity:25/100 - (25%)
Similarity:28/100 - (28%) Gaps:38/100 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  2558 VAPPPFAGYSQPTSPKPPQTLPKPGTYSPGSLGASPAQGASTMPRLGQHSPASPSFQRPGSGNQL 2622
            |.|...|.|       .|.....|..|||....|                 |.||....||... 
Mosquito    23 VVPSYSAAY-------VPSAYAYPSVYSPYVAAA-----------------AYPSVWAWGSNKN- 62

  Fly  2623 LTANAVPKPYQSDALKSPSALVSPS-MLNRTYDTT 2656
                      :.||  :|.|...|| :||....||
Mosquito    63 ----------KDDA--APRAFARPSALLNNQKPTT 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 316..555 CDD:238113
LOC3291433XP_061514351.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.