DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and HPN

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:262 Identity:103/262 - (39%)
Similarity:131/262 - (50%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 CGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPNSNM 370
            ||......:|||||..|..|..||||:|...|    ...|||:|:|..||:|||||.   |..|.
Human   153 CGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDG----AHLCGGSLLSGDWVLTAAHCF---PERNR 210

  Fly   371 KIRLGEWDV-RGQEERLNHE--EYGIERKEVHPHY------NPADFVNDVALIRLDRNVVYKQHI 426
            .  |..|.| .|...:.:..  :.|::....|..|      |..:..||:||:.|...:...::|
Human   211 V--LSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYI 273

  Fly   427 IPVCLPPSTTKLT-GKMATVAGWGRTR-HGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIH 489
            .|||||.:...|. ||:.||.|||.|: :||..  .||||..|.:||||.|.   .|......|.
Human   274 QPVCLPAAGQALVDGKICTVTGWGNTQYYGQQA--GVLQEARVPIISNDVCN---GADFYGNQIK 333

  Fly   490 DVFLCAGYKDGGRDSCQGDSGGPL----TLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVP 550
            ....||||.:||.|:||||||||.    :::...|..|.|:||||.||.....|||||.:..|..
Human   334 PKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFRE 398

  Fly   551 WI 552
            ||
Human   399 WI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 99/251 (39%)
Tryp_SPc 316..555 CDD:238113 100/252 (40%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275 2/5 (40%)
Tryp_SPc 163..400 CDD:238113 98/250 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.