DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and CG31827

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:231 Identity:74/231 - (32%)
Similarity:120/231 - (51%) Gaps:12/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 PWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPNSNMKIRLGEWDVRGQEERLNHEEYG 392
            ||.:|:|.:    |.|..||:||:...|:||||.:.:....::.:..|||:.....|:...||..
  Fly    56 PWTIAVIHN----RSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAF 116

  Fly   393 IERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQST 457
            :.:..:|..:|.....|::||:.|||.......|..:|||.....|:.....|||||:.:...:.
  Fly   117 VLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTH 181

  Fly   458 VPSVLQEVDVEVISNDRCQRWFRAA--GRREAIHDVFLCA-GYKDGGRDSCQGDSGGPL--TLTM 517
            ...||:::|:.::....||...|..  |:...:....:|| |.||  .|:|.||.||.|  .:|.
  Fly   182 YGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEKD--NDACTGDGGGALFCPMTE 244

  Fly   518 DGRK-TLIGLVSWGIGCGREHLPGVYTNIQRFVPWI 552
            |.:: ..||:|:||:||..:::|..||::..|.|||
  Fly   245 DPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 72/229 (31%)
Tryp_SPc 316..555 CDD:238113 74/231 (32%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 74/231 (32%)
Tryp_SPc 50..280 CDD:214473 72/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.