DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and CG32755

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:258 Identity:81/258 - (31%)
Similarity:131/258 - (50%) Gaps:31/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 RIVGGHSTGFGSHPWQVALIKSGFLTRKLS----CGGALISNRWVITAAHCVA---STP----NS 368
            :||||::......|:||::.:.....|...    ||||:||.|.|.:||||.|   |.|    :.
  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101

  Fly   369 NMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQ---HIIPVC 430
            .:.:.:.......:.:|.. :||.::|...|..||.:...||:||:.|:..:.::.   ..||:.
  Fly   102 ELYVVVAGSSAIDRTDRFT-QEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLA 165

  Fly   431 LPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCA 495
            :....   .|....:.|||:....:.:  :.||:..|.:::.:.||..::....:       :||
  Fly   166 IKAPE---EGTTCLIHGWGKVTMKEKS--ASLQQAPVPILNKELCQVIYKLPASQ-------MCA 218

  Fly   496 GYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKVMAN 558
            |:..||.|:||||||||  |..|||  |.|::|||:||.....||||||:..|:.||.:..|:
  Fly   219 GFLQGGIDACQGDSGGP--LICDGR--LAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANAS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 78/250 (31%)
Tryp_SPc 316..555 CDD:238113 80/252 (32%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 78/250 (31%)
Tryp_SPc 38..273 CDD:238113 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.