DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and Tmprss6

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:273 Identity:107/273 - (39%)
Similarity:143/273 - (52%) Gaps:22/273 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 GSGGYHDASYRPVPGCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWV 355
            |.....|.|......|| :...|:|||||..:..|..|||.:|...|    :..||||||::|||
  Rat   553 GQADCRDGSDEEHCDCG-LQGPSSRIVGGAMSSEGEWPWQASLQIRG----RHICGGALIADRWV 612

  Fly   356 ITAAHCVASTPNSNMKIRLGEWDVRGQEERLNHE-----EYGIERKEVHPHYNPADFVNDVALIR 415
            ||||||......::.::    |.|...:.|.|..     .:.:.|..:||::.......||||::
  Rat   613 ITAAHCFQEDSMASPRL----WTVFLGKMRQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQ 673

  Fly   416 LDRNVVYKQHIIPVCLPPSTTKL-TGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWF 479
            ||..|||...:.|||||..:... .|:...:.|||..|.| ....|.||:|||::|..|.|...:
  Rat   674 LDHPVVYSATVRPVCLPARSHFFEPGQHCWITGWGAQREG-GPGSSTLQKVDVQLIPQDLCNEAY 737

  Fly   480 RAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTL-TMDGRKTLIGLVSWGIGCGREHLPGVYT 543
                 |..:....|||||:.|.:|:|||||||||.. ...||..|.||||||:||||.:..||||
  Rat   738 -----RYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKEPSGRWFLAGLVSWGLGCGRPNFFGVYT 797

  Fly   544 NIQRFVPWINKVM 556
            .:.|.|.||.:|:
  Rat   798 RVTRVVNWIQQVL 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 98/243 (40%)
Tryp_SPc 316..555 CDD:238113 99/245 (40%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486 3/12 (25%)
Tryp_SPc 576..806 CDD:214473 98/243 (40%)
Tryp_SPc 577..809 CDD:238113 99/245 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.