DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and CG6048

DIOPT Version :10

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:190 Identity:32/190 - (16%)
Similarity:61/190 - (32%) Gaps:66/190 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1365 QAAPGQKECDGAIRSIESLRPLLESPQ-----ESLTDQGYFDCLDTVLEKSRTLGEGMTGIANNA 1424
            |.||...:...:..::..::.::|.|.     :..|....||....::|:.|.  :|...:...|
  Fly    77 QCAPASGDSKSSAFAVFDMKYIVEIPNRIPSVKCFTRNRLFDMESAIVEQYRK--DGKLPLEKTA 139

  Fly  1425 KNSKHV---EFGHSVNSVSESIRGLIESAAQAAYLVGVSNPTSVGGRPGIVDPAQYARAAQAIRQ 1486
            .:...|   |:|.|.                   ::|....|...|  ||..|      ...:.:
  Fly   140 LHLTEVGCIEYGGST-------------------IIGEDTTTKKSG--GITLP------PTVLPE 177

  Fly  1487 SCDVLRGQASSQPQVLSAA------------------------TVIAKHTSALCNACRNA 1522
            .|:     .|..||:::..                        ||..:|.|.:|::.:.|
  Fly   178 DCN-----CSKPPQLITQTIFDKQYAFNFPQTKFTFGTPSFTYTVGCQHVSMICSSSQKA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 316..555 CDD:238113
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 32/190 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.