DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and Tmprss3

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:365 Identity:115/365 - (31%)
Similarity:155/365 - (42%) Gaps:77/365 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 PSSSSSSSL--NSWEHETGGHLGSISGITNHLDSFFDAESQAPLDSAGAPPPHEPLPNAQAFAVG 273
            ||..||..|  ::.|.:..|...||    |||         .|.|...|  .|..:...:....|
  Rat   148 PSYVSSDHLRVDALEEQFQGDFVSI----NHL---------LPDDKVTA--LHHSVYMREGCTSG 197

  Fly   274 NVLDLNAGEAADEYQSGGSGGYHDASYRPVPGCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGF 338
            :|:.|...                       .||.....|.|||||:.:.....||||:|...|:
  Rat   198 HVVTLKCS-----------------------ACGMRTGYSPRIVGGNVSSLTQWPWQVSLQFQGY 239

  Fly   339 LTRKLSCGGALISNRWVITAAHCVAST--PNSNMKIRLGEWDVR-GQEERLNH--EEYGIERKEV 398
            ..    |||::|:..|::||||||...  |.|        |.|: |....::.  ..:.:|:...
  Rat   240 HL----CGGSVITPLWIVTAAHCVYDLYHPKS--------WTVQVGLVSLMDSPVPSHLVEKIIY 292

  Fly   399 HPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKL-TGKMATVAGWGRTRHGQSTVPSVL 462
            |..|.|....||:||::|...:.:.:.|.|:|||.|.... .||:...:|||.|..|......||
  Rat   293 HSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNSEENFPDGKLCWTSGWGATEDGAGDASPVL 357

  Fly   463 QEVDVEVISNDRCQRWFRAAGRREAIHDVF--------LCAGYKDGGRDSCQGDSGGPLTLTMDG 519
            ....|.:|||..|..           .||:        |||||..||.|||||||||||......
  Rat   358 NHAAVPLISNKICNH-----------RDVYGGIISPSMLCAGYLKGGVDSCQGDSGGPLVCQERR 411

  Fly   520 RKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKVMAND 559
            ...|:|..|:||||...:.|||||.|..|:.||::.:..|
  Rat   412 LWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHEQLERD 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 90/250 (36%)
Tryp_SPc 316..555 CDD:238113 91/252 (36%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 21/100 (21%)
Tryp_SPc 216..444 CDD:214473 90/250 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44824
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.