DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:270 Identity:93/270 - (34%)
Similarity:132/270 - (48%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 VPGCG--EVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVAST 365
            |||||  :|....:||||||:...|:.|||.:|    .|.:...|||:|:|..||:|||||.:.:
  Rat    15 VPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASL----RLQKVHVCGGSLLSPEWVLTAAHCFSGS 75

  Fly   366 PN-SNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYN-------------PADFVNDVALIRL 416
            .| |:.::.|||..:                 .:.||::             |.....|:||::|
  Rat    76 VNSSDYEVHLGELTI-----------------TLSPHFSTVKQIIMYSSAPGPPGSSGDIALVQL 123

  Fly   417 DRNVVYKQHIIPVCLPPSTTKL-TGKMATVAGWGRTRHGQSTVPSV-LQEVDVEVISNDRCQRWF 479
            ...|.....:.|||||.::... .|....|.|||.|:.|:...|.. |||..|.|:..:.|.:.:
  Rat   124 ATPVALSSQVQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAY 188

  Fly   480 RAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTN 544
             ::.....|....|||.   |..|:||.||||||...:.|.....|:||||.||||...||||..
  Rat   189 -SSSNGSLIQSDMLCAW---GPGDACQDDSGGPLVCRVAGIWQQAGVVSWGEGCGRPDRPGVYAR 249

  Fly   545 IQRFVPWINK 554
            :..:|.||::
  Rat   250 VTAYVNWIHR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 85/252 (34%)
Tryp_SPc 316..555 CDD:238113 86/255 (34%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 85/252 (34%)
Tryp_SPc 30..260 CDD:238113 86/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.