DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and TMPRSS11E

DIOPT Version :10

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:269 Identity:87/269 - (32%)
Similarity:122/269 - (45%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 CG----EVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTP 366
            ||    :...:|.|||||.....|..|||.:|...|    ...||..||:..|:::||||..:..
Human   178 CGTRRSKTLGQSLRIVGGTEVEEGEWPWQASLQWDG----SHRCGATLINATWLVSAAHCFTTYK 238

  Fly   367 N--------------SNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLD 417
            |              |.||        ||....:.||:|      .||.:   |:  |::|..|.
Human   239 NPARWTASFGVTIKPSKMK--------RGLRRIIVHEKY------KHPSH---DY--DISLAELS 284

  Fly   418 RNVVYKQHIIPVCLPPSTTKL-TGKMATVAGWGRTRH-GQSTVPSVLQEVDVEVISNDRCQRWFR 480
            ..|.|...:..||||.::.:. .|.:..|.|:|..:: |.|  .:.|::..|.:|....|.   .
Human   285 SPVPYTNAVHRVCLPDASYEFQPGDVMFVTGFGALKNDGYS--QNHLRQAQVTLIDATTCN---E 344

  Fly   481 AAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKT--LIGLVSWGIGCGREHLPGVYT 543
            .....:||....||||..:|..|:||||||||| ::.|.|..  |.|:||||..|.:.:.|||||
Human   345 PQAYNDAITPRMLCAGSLEGKTDACQGDSGGPL-VSSDARDIWYLAGIVSWGDECAKPNKPGVYT 408

  Fly   544 NIQRFVPWI 552
            .:.....||
Human   409 RVTALRDWI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 316..555 CDD:238113 83/255 (33%)
TMPRSS11ENP_054777.2 SEA 51..147 CDD:460188
Tryp_SPc 192..420 CDD:238113 83/255 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.