DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and Prss29

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:253 Identity:97/253 - (38%)
Similarity:146/253 - (57%) Gaps:20/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 IVGGHSTGFGSHPWQVAL--IKSGFLTRKLSCGGALISNRWVITAAHCV--ASTPNSNMKIRLGE 376
            ||||:|...|..||||:|  .:..:.:....|||::|..:||:|||||:  :....|..:|.||:
  Rat    31 IVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYLGQ 95

  Fly   377 WDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKLTGK 441
            ..:.|.|:.|.     :.|..:||.:..:...:||||::|.::|....::.||.|.|::.::|.|
  Rat    96 VYLYGGEKLLK-----VSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLEVTKK 155

  Fly   442 -MATVAGWGR-TRHGQSTVPSVLQEVDVEVISNDRCQRWFRAA------GRREAIHDVFLCAGYK 498
             :..|.|||. :.|.....|..||:|.|:::.|..|::.:|.|      |:|..:.|: ||||  
  Rat   156 DVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDM-LCAG-- 217

  Fly   499 DGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKVM 556
            ..|||||.|||||||...:.|..||:|:||||.||..:.:||||..:|.|:|||...|
  Rat   218 SHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWITGQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 94/247 (38%)
Tryp_SPc 316..555 CDD:238113 96/250 (38%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.