DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and PRSS33

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:281 Identity:98/281 - (34%)
Similarity:133/281 - (47%) Gaps:40/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 SGGSGGYHDASYRPVPGCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNR 353
            :.|:.|...|:      ||:. ..|:|||||.....|..|||.::...|...    |||:||:.:
Human    17 AAGTQGRKSAA------CGQP-RMSSRIVGGRDGRDGEWPWQASIQHRGAHV----CGGSLIAPQ 70

  Fly   354 WVITAAHCV--ASTPNSNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRL 416
            ||:|||||.  .:.| :..::|||...:.....|.  ....:.|..:.|.|:......|:||::|
Human    71 WVLTAAHCFPRRALP-AEYRVRLGALRLGSTSPRT--LSVPVRRVLLPPDYSEDGARGDLALLQL 132

  Fly   417 DRNVVYKQHIIPVCLP-PSTTKLTGKMATVAGWGRTRHGQSTVP----SVLQEVDVEVISNDRCQ 476
            .|.|.....:.||||| |......|....|.|||..|.|   ||    ..||.|.|.::.:..|.
Human   133 RRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPG---VPLPEWRPLQGVRVPLLDSRTCD 194

  Fly   477 RWFRAAGRREAIHDV----------FLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGI 531
            ..:....      ||          .|||||..|.:|:||||||||||....|...|:|:||||.
Human   195 GLYHVGA------DVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGK 253

  Fly   532 GCGREHLPGVYTNIQRFVPWI 552
            ||...:.|||||::..:.|||
Human   254 GCALPNRPGVYTSVATYSPWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 90/253 (36%)
Tryp_SPc 316..555 CDD:238113 91/254 (36%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 91/254 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426785at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.