DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and Klkb1

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:278 Identity:98/278 - (35%)
Similarity:148/278 - (53%) Gaps:30/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 YQSGGSGGYHDASYR--PVPGCGEVYTRSN-RIVGGHSTGFGSHPWQVAL-IKSGFLTRKLSCGG 347
            |::.||.||   |.|  .|....:..|:.| |||||.::..|..||||:| :|  .:::...|||
  Rat   362 YEAQGSSGY---SLRLCKVVESSDCTTKINARIVGGTNSSLGEWPWQVSLQVK--LVSQNHMCGG 421

  Fly   348 ALISNRWVITAAHCVASTPNSNMKIRLGEWDVRG----QEERLNHEEY-GIERKEVHPHYNPADF 407
            ::|..:|::|||||....|..::      |.:.|    ..|..|...: .|:...:|..|..::.
  Rat   422 SIIGRQWILTAAHCFDGIPYPDV------WRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEG 480

  Fly   408 VNDVALIRLDRNVVYKQHIIPVCLPPSTTKLTGKMAT---VAGWGRTRHGQSTVPSVLQEVDVEV 469
            ..|:|||:|...:.|.:...|:|||....  |..:.|   |.|||.|:....| .::||:..:.:
  Rat   481 SYDIALIKLQTPLNYTEFQKPICLPSKAD--TNTIYTNCWVTGWGYTKERGET-QNILQKATIPL 542

  Fly   470 ISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCG 534
            :.|:.||:.:    |...|....:|||||:||.|:|:|||||||.....||..|:|:.|||.||.
  Rat   543 VPNEECQKKY----RDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCA 603

  Fly   535 REHLPGVYTNIQRFVPWI 552
            |:..|||||.:..::.||
  Rat   604 RKEQPGVYTKVAEYIDWI 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 86/245 (35%)
Tryp_SPc 316..555 CDD:238113 87/246 (35%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519 7/15 (47%)
Tryp_SPc 390..621 CDD:214473 86/245 (35%)
Tryp_SPc 391..621 CDD:238113 85/244 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 189 1.000 Domainoid score I3197
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44824
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.