DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and TPSD1

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:233 Identity:80/233 - (34%)
Similarity:110/233 - (47%) Gaps:33/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 PVPGCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSG-----FLTRKLSCGGALISNRWVITAAHC 361
            |.||..   .:...||||........||||:|...|     |      |||:||..:||:|||||
Human    27 PAPGQA---LQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHF------CGGSLIHPQWVLTAAHC 82

  Fly   362 VASTPN----SNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVY 422
            |  .|:    :.::::|.|..:..|::.|     .:.|..|||.:.......|:||:.|:..|..
Human    83 V--EPDIKDLAALRVQLREQHLYYQDQLL-----PVSRIIVHPQFYIIQTGADIALLELEEPVNI 140

  Fly   423 KQHIIPVCLPP-STTKLTGKMATVAGWGRTRHGQSTVPSV-LQEVDVEVISNDRCQRWFRA---A 482
            ..||..|.||| |.|...|....|.|||...:.....|.. |:||:|.|:.|..|...:..   .
Human   141 SSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHT 205

  Fly   483 GRR-EAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDG 519
            |.. :.:.|..||||.::  .|||||||||||...::|
Human   206 GHSFQIVRDDMLCAGSEN--HDSCQGDSGGPLVCKVNG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 77/220 (35%)
Tryp_SPc 316..555 CDD:238113 77/219 (35%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 77/219 (35%)
Tryp_SPc 38..240 CDD:214473 76/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152882
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.