DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:250 Identity:93/250 - (37%)
Similarity:126/250 - (50%) Gaps:22/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 IVGGHSTGFGSHPWQVALIKSGFLTRKLS-----CGGALISNRWVITAAHCVASTPNSNMKIRLG 375
            |||||.......||||:      |..||:     |||:||..:||:||||||.....|....|: 
Mouse    32 IVGGHEASESKWPWQVS------LRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRV- 89

  Fly   376 EWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPP-STTKLT 439
              .:|.|......:...:.|..|||||..|:...||||:.|:..|....|:.|:.||| |.|...
Mouse    90 --QLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISLPPASETFPP 152

  Fly   440 GKMATVAGWGRTRHGQSTVPSV-LQEVDVEVISNDRCQRWFR----AAGRREAIHDVFLCAGYKD 499
            |....|.|||...:.:...|.. |::|.|.::.|..|.|.:.    .......:||..||||  :
Mouse   153 GTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAG--N 215

  Fly   500 GGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINK 554
            ..||||||||||||...:.|.....|:||||.||.:.:.||:||.:..::.||::
Mouse   216 TRRDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 91/246 (37%)
Tryp_SPc 316..555 CDD:238113 93/249 (37%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 93/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842952
Domainoid 1 1.000 166 1.000 Domainoid score I3858
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.