DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:299 Identity:110/299 - (36%)
Similarity:146/299 - (48%) Gaps:46/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 QSGGSGGYHDASYRPVPGCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISN 352
            |..|.....|.|......|| :...|:|||||..:..|..|||.:|...|    :..||||||::
Human   541 QCDGRPDCRDGSDEEHCDCG-LQGPSSRIVGGAVSSEGEWPWQASLQVRG----RHICGGALIAD 600

  Fly   353 RWVITAAHC-----VASTPNSNMKIRLGE-WDVRGQEERLNHE-EYGIERKEVHPHYNPADFVND 410
            |||||||||     :|||  ....:.||: |    |..|...| .:.:.|..:||::.......|
Human   601 RWVITAAHCFQEDSMAST--VLWTVFLGKVW----QNSRWPGEVSFKVSRLLLHPYHEEDSHDYD 659

  Fly   411 VALIRLDRNVVYKQHIIPVCLPPSTTKL-TGKMATVAGWGRTRHGQ------------------- 455
            |||::||..||....:.|||||..:... .|....:.|||..|.|.                   
Human   660 VALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGALRADAVALFYGWRNQGSET 724

  Fly   456 --STVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTL-TM 517
              ..:.:.||:|||::|..|.|...:     |..:....|||||:.|.:|:|||||||||.. .:
Human   725 CCCPISNALQKVDVQLIPQDLCSEVY-----RYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKAL 784

  Fly   518 DGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKVM 556
            .||..|.||||||:||||.:..||||.|...:.||.:|:
Human   785 SGRWFLAGLVSWGLGCGRPNYFGVYTRITGVISWIQQVV 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 100/266 (38%)
Tryp_SPc 316..555 CDD:238113 101/268 (38%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486 4/15 (27%)
Tryp_SPc 568..822 CDD:238113 101/268 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.