DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:292 Identity:96/292 - (32%)
Similarity:140/292 - (47%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 ASYRPVPG-------------------CGEVYTRS----NRIVGGHSTGFGSHPWQVALIKSGFL 339
            ||:..||.                   ||.....|    |:||.|.|:..|:.|||.::...|  
Human   144 ASWNAVPASIKLMEISKAASEMLTNNCCGRQVANSIITGNKIVNGKSSLEGAWPWQASMQWKG-- 206

  Fly   340 TRKLSCGGALISNRWVITAAHCVASTPNSNMKIRLGEWDVRGQEERLNHEEYGI-------ERKE 397
              :..||.:|||:||:::||||.|...||.      :|.|          .:||       .||.
Human   207 --RHYCGASLISSRWLLSAAHCFAKKNNSK------DWTV----------NFGIVVNKPYMTRKV 253

  Fly   398 ----VHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKLT-GKMATVAGWGRTRHGQST 457
                .|.:|:.....:|:||::|...|.:.::|..:|||.:..||: .....|.||| |.:...:
Human   254 QNIIFHENYSSPGLHDDIALVQLAEEVSFTEYIRKICLPEAKMKLSENDNVVVTGWG-TLYMNGS 317

  Fly   458 VPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKT 522
            .|.:|||..:::|.|..|...:..:|   .:.|..||||:..|..|:||.||||||... |.|..
Human   318 FPVILQEDFLKIIDNKICNASYAYSG---FVTDTMLCAGFMSGEADACQNDSGGPLAYP-DSRNI 378

  Fly   523 --LIGLVSWGIGCGREHLPGVYTNIQRFVPWI 552
              |:|:||||.|||:::.|||||.:..:..||
Human   379 WHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 86/250 (34%)
Tryp_SPc 316..555 CDD:238113 88/251 (35%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699
Tryp_SPc 184..410 CDD:214473 86/250 (34%)
Tryp_SPc 185..413 CDD:238113 88/251 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.