powered by:
Protein Alignment CG8172 and LOC110437811
DIOPT Version :9
Sequence 1: | NP_001097235.2 |
Gene: | CG8172 / 35905 |
FlyBaseID: | FBgn0033362 |
Length: | 561 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021326334.1 |
Gene: | LOC110437811 / 110437811 |
-ID: | - |
Length: | 255 |
Species: | Danio rerio |
Alignment Length: | 73 |
Identity: | 34/73 - (46%) |
Similarity: | 43/73 - (58%) |
Gaps: | 13/73 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 493 LCAGYKDGGRDSCQGDSGGPLTL-TMDGRKTLIGLVSWGIGCG------------REHLPGVYTN 544
:|||.:.||||:|||||||||.. ..|||...:|:.|||.||| |...|||:|:
Zfish 1 MCAGPERGGRDACQGDSGGPLLCPRADGRWVAVGVTSWGKGCGRSWNNNKFKPGSRRGSPGVFTD 65
Fly 545 IQRFVPWI 552
:..|:.||
Zfish 66 VLMFLSWI 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D426785at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.