DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and LOC110437811

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_021326334.1 Gene:LOC110437811 / 110437811 -ID:- Length:255 Species:Danio rerio


Alignment Length:73 Identity:34/73 - (46%)
Similarity:43/73 - (58%) Gaps:13/73 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 LCAGYKDGGRDSCQGDSGGPLTL-TMDGRKTLIGLVSWGIGCG------------REHLPGVYTN 544
            :|||.:.||||:|||||||||.. ..|||...:|:.|||.|||            |...|||:|:
Zfish     1 MCAGPERGGRDACQGDSGGPLLCPRADGRWVAVGVTSWGKGCGRSWNNNKFKPGSRRGSPGVFTD 65

  Fly   545 IQRFVPWI 552
            :..|:.||
Zfish    66 VLMFLSWI 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 32/71 (45%)
Tryp_SPc 316..555 CDD:238113 34/73 (47%)
LOC110437811XP_021326334.1 Tryp_SPc <1..76 CDD:328812 34/73 (47%)
CUB 97..198 CDD:238001
CUB 210..>252 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426785at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.