DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and LOC105948396

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_031749233.1 Gene:LOC105948396 / 105948396 -ID:- Length:246 Species:Xenopus tropicalis


Alignment Length:210 Identity:80/210 - (38%)
Similarity:108/210 - (51%) Gaps:18/210 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 CGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVAST-PNSN 369
            ||.....| ||:||..:..|..||||.:....|..    |||:||:|.||::||||...| |.|.
 Frog    27 CGRRQLLS-RIMGGQDSKAGMWPWQVMIYSEAFEL----CGGSLITNNWVVSAAHCFNRTKPPSF 86

  Fly   370 MKIRLGEWDVRGQEERLNHEEYGIERKE--VHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLP 432
            ..:.||.:.:    ..||..|..:..|:  |||:|...:..:|:||:.|..:::|..||.|||||
 Frog    87 YTVYLGVYQI----SVLNGNEVAMPIKQFIVHPNYTVPENGSDIALVELSGDIIYTNHIQPVCLP 147

  Fly   433 PSTTKL-TGKMATVAGWGRTRHGQS-TVPSVLQEVDVEVISNDRCQRWFRAAG----RREAIHDV 491
            .....| ||....|.|||......| ..|:.||||.|.:|.|.:|...|:...    :...|.:.
 Frog   148 TGGVNLPTGLQCWVTGWGNIASNVSLPEPNTLQEVAVPLIGNQQCNALFQVPSPIDPKTYVISND 212

  Fly   492 FLCAGYKDGGRDSCQ 506
            .||||:.|||:||||
 Frog   213 MLCAGFIDGGKDSCQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 77/201 (38%)
Tryp_SPc 316..555 CDD:238113 76/200 (38%)
LOC105948396XP_031749233.1 Tryp_SPc 36..>227 CDD:238113 74/198 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426785at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.