DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and Prss50

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_017451624.2 Gene:Prss50 / 100910205 RGDID:6499372 Length:424 Species:Rattus norvegicus


Alignment Length:245 Identity:68/245 - (27%)
Similarity:117/245 - (47%) Gaps:36/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 PWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPNSNMKIRLGE-W---------DVRGQ 382
            ||.|::..:|    ...|.|.||:::||:..|||: |....|..:|:|. |         ||...
  Rat   164 PWMVSVQTNG----SHVCAGILIASQWVLAVAHCL-SQNRVNYTVRVGSPWINQTTETSSDVPVN 223

  Fly   383 EERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKL-TGKMATVA 446
            :..:|.   |.:.|.   :::....::|:.|::|...:.|.:::.|||||.....: .|.:.||.
  Rat   224 QVIINS---GYQSKR---YWSWVGRIHDIGLLKLKWGLKYSKYVWPVCLPGLEYVVEDGSLCTVT 282

  Fly   447 GWGRTR-HGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDV-------FLCAGYKDGGRD 503
            |||..: :|.......|||.:|.::::..|:.::....|   ||.:       .:||  .|..|:
  Rat   283 GWGYPKANGLWPQFQTLQEKEVSILNSRECEHYYHKFSR---IHSLVRIISPQMICA--LDNDRE 342

  Fly   504 S-CQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWI 552
            . |...||.||..:.||...|:|::|||.||.:...|.::..:..:..||
  Rat   343 KFCYERSGEPLVCSSDGMWYLVGVMSWGPGCKKSEAPPIFLQVSHYQLWI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 66/243 (27%)
Tryp_SPc 316..555 CDD:238113 68/245 (28%)
Prss50XP_017451624.2 Tryp_SPc 162..392 CDD:238113 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.