DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and ovch2

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:280 Identity:96/280 - (34%)
Similarity:144/280 - (51%) Gaps:39/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PG------CGEVYTRS-------NRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWV 355
            ||      |||....|       :|||||..:..|.|||.|:|.::|    |..|||.|:|.|.|
 Frog    39 PGSIRGARCGESPLGSARDLNYLSRIVGGRESKKGQHPWTVSLKRNG----KHFCGGILVSRRHV 99

  Fly   356 ITAAHCVAS-TPNSNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVN-DVALIRLDR 418
            :||:||:.. ...|.:::..||:|...:|:  ..:.:.:.....||.:|....:| |||::.||.
 Frog   100 LTASHCLLDRNVKSYIRVFFGEYDQTIKED--TEQTFKVIEIFKHPDFNYTQPMNYDVAVLVLDG 162

  Fly   419 NVVYKQHIIPVCLP-PSTTKLTGKMATVAGWGR-TRHGQSTVPSVLQEVDVEVISNDRCQRWFRA 481
            .|.:..:|.|.|:| |......|.:....|||. |.:|  .:|.|||||.:.:::...|.. ..|
 Frog   163 AVTFDDNIQPACMPNPDDVFEPGDLCVTLGWGHLTENG--ILPGVLQEVLLPLVNLSICLD-VMA 224

  Fly   482 AGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTL-TMDGRKTLIGLVSWGIGCG----------- 534
            ..:...:....:|||:.:||:|:|||||||||.. ...|...|.||.|||:|||           
 Frog   225 TLKGAVVSSKIVCAGFPEGGKDACQGDSGGPLLCQRRHGTWVLHGLTSWGMGCGRSWKNNMFLPA 289

  Fly   535 -REHLPGVYTNIQRFVPWIN 553
             |:..||::|:||:.:.|::
 Frog   290 NRKGSPGIFTDIQKLLGWVS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 89/253 (35%)
Tryp_SPc 316..555 CDD:238113 89/255 (35%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113 89/253 (35%)
CUB 330..436 CDD:238001
CUB 447..558 CDD:238001
Tryp_SPc 606..832 CDD:238113
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426785at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.