DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and zgc:165423

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:256 Identity:92/256 - (35%)
Similarity:136/256 - (53%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PGCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPN- 367
            |.||:. ..:.:||||.:...||.|||.:|.:||    ...|||:|||::|:::||||..|.|| 
Zfish    27 PACGKA-PLNTKIVGGTNASAGSWPWQASLHESG----SHFCGGSLISDQWILSAAHCFPSNPNP 86

  Fly   368 SNMKIRLGEWDVRGQEERL---NHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPV 429
            |:..:.||.     |.:.|   |.....:.:..|||.|..:...||:||:.|...|.:..:|.||
Zfish    87 SDYTVYLGR-----QSQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPV 146

  Fly   430 CLPPSTTKLTGKMATVAGWGRTRHGQS-TVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFL 493
            ||....:........:.|||....|.| ..|.:||||:|.::.|:.|...:   |...:|.:..:
Zfish   147 CLAADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLY---GGGSSITNNMM 208

  Fly   494 CAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINK 554
            |||...||:||||||||||:.:.........|:||:|.||...:.||||..:.::..||::
Zfish   209 CAGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 87/241 (36%)
Tryp_SPc 316..555 CDD:238113 89/244 (36%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 87/241 (36%)
Tryp_SPc 38..269 CDD:238113 89/242 (37%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.