DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:247 Identity:91/247 - (36%)
Similarity:137/247 - (55%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 RIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPN----SNMKIRLG 375
            |||||.....||.||||. |:.|  :....|||::|:..||::||||.   ||    |...:.:|
Zfish    31 RIVGGVEASPGSWPWQVD-IQMG--SNGHVCGGSIIAKNWVLSAAHCF---PNPSEVSAYTLYMG 89

  Fly   376 EWDVRG--QEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKL 438
            ...:.|  |.|::::    ::|..:...|.......||||::|...|.:...|.|||||.:..:.
Zfish    90 RHLLNGYNQFEKVSY----VQRVVIPEGYTDPQGGRDVALVQLRAPVSWTDRIQPVCLPFADFQF 150

  Fly   439 -TGKMATVAGWGRTRHGQS-TVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDV---FLCAGYK 498
             :|.:..|.|||..:.|.| |..:.|:||:|.:|....||..::......:..|:   .:|||||
Zfish   151 NSGTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSSCQFMYQILSSDSSTVDILSDMICAGYK 215

  Fly   499 DGGRDSCQGDSGGPLTLTMDGRKTLI--GLVSWGIGCGREHLPGVYTNIQRF 548
            :||:|||||||||||...: |..|.|  |:||:|:||.:::.||:|:.:..|
Zfish   216 EGGKDSCQGDSGGPLVCPV-GNGTWIQAGVVSFGLGCAQKNRPGIYSRVSSF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 91/247 (37%)
Tryp_SPc 316..555 CDD:238113 90/246 (37%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 90/246 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587666
Domainoid 1 1.000 188 1.000 Domainoid score I3236
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.