DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and tmprss3a

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:264 Identity:97/264 - (36%)
Similarity:133/264 - (50%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 CGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPNSNM 370
            ||.....|.|||||:.:..|..||||:|   .|....| |||::|::||::||||||........
Zfish   288 CGSRPKFSARIVGGNLSAEGQFPWQVSL---HFQNEHL-CGGSIITSRWILTAAHCVYGIAYPMY 348

  Fly   371 KIRLGEWDVRG--QEERLNH-EEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLP 432
                  |.|..  .|..||. :.:.:|:...|..|.|....:|:||::|.:.:.:...:.|:|||
Zfish   349 ------WMVYAGLTELPLNAVKAFAVEKIIYHSRYRPKGLDHDIALMKLAQPLTFNGMVEPICLP 407

  Fly   433 PSTTKL-TGKMATVAGWGRTRHGQSTVPSVLQE-VDVEVISNDRCQ-----RWFRAAGRREAIHD 490
            ....:. .|||..::|||.|..|...  ||.|. ..|.:|||..|.     :.:..||       
Zfish   408 NFGEQFEDGKMCWISGWGATEDGGDA--SVSQHCASVPLISNKACSQPEVYQGYLTAG------- 463

  Fly   491 VFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKV 555
             .:||||.|||.|||||||||||.........|:|..|||.||..::.|||||.|.:.:.||:..
Zfish   464 -MICAGYLDGGTDSCQGDSGGPLACEDSSIWKLVGATSWGQGCAEKNKPGVYTRITQSLTWIHLQ 527

  Fly   556 MAND 559
            |..:
Zfish   528 MERE 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 91/246 (37%)
Tryp_SPc 316..555 CDD:238113 92/248 (37%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 2/3 (67%)
Tryp_SPc 298..525 CDD:238113 91/246 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.