DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and PRSS27

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:273 Identity:107/273 - (39%)
Similarity:149/273 - (54%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 CGR-RMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSD 851
            ||| ||.  .|:|||.:...|.||||:|::  |..:  |.||.:|:.|.|.:|||||..|...:.
Human    26 CGRPRML--NRMVGGQDTQEGEWPWQVSIQ--RNGS--HFCGGSLIAEQWVLTAAHCFRNTSETS 84

  Fly   852 LL-LRLGEYDLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPD 915
            |. :.||...|.:......|  .||:.|.|:|.:.......|:||:....||.|...|:|||:||
Human    85 LYQVLLGARQLVQPGPHAMY--ARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPD 147

  Fly   916 NDENF-IGQTAFVTGWGRLYEDG--PLPSVLQEVAVPVINNTICESMY---RSAGY-IEHIPHIF 973
            ....| .|...:|||||...|:.  |.|.:||::|||:|:...|..:|   ...|| .:.|.:..
Human   148 PSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDM 212

  Fly   974 ICAGWKKGGYDSCEGDSGGPMV-------LQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEF 1031
            :|||:::|..|:|:||||||:|       ||         .||||||.|||..|:||||.|::..
Human   213 LCAGFEEGKKDACKGDSGGPLVCLVGQSWLQ---------AGVISWGEGCARQNRPGVYIRVTAH 268

  Fly  1032 RDWINQI---LQF 1041
            .:||::|   |||
Human   269 HNWIHRIIPKLQF 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 96/252 (38%)
Tryp_SPc 798..1038 CDD:238113 97/254 (38%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 96/252 (38%)
Tryp_SPc 36..275 CDD:238113 97/253 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.