DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and prss60.1

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:264 Identity:104/264 - (39%)
Similarity:150/264 - (56%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   787 VCGRRMFP-EPRIVGGANAAFGRWPWQISLRQWRTSTY-LHKCGAALLNENWAITAAHCVDNVPP 849
            |||  :.| ..|||||.||..|.||||:||   .:..| .|.||.:|:|..|.:|||||:..:..
Zfish    24 VCG--LAPLNNRIVGGVNAFDGSWPWQVSL---HSPIYGGHFCGGSLINSEWVLTAAHCLPRITT 83

  Fly   850 SDLLLRLGEYDLAEEEEPYGYQ-ERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCV 913
            |.||:.||:   ..::....|: .|.|.::..||.::..|.|.|:|||.....|.|...|.|||:
Zfish    84 SSLLVFLGK---TTQQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFSNYIRPVCL 145

  Fly   914 PDNDENF-IGQTAFVTGWG--RLYEDGPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFIC 975
            ...:..| .|.::::||||  :|..:.|.|.:|||..:||:.|..|.::..|..    :.:..||
Zfish   146 AAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALLGSGS----VTNNMIC 206

  Fly   976 AGWKKGGYDSCEGDSGGPMVLQR-----ESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWI 1035
            ||..:||.|:|:||||||||.::     :|       |:.|||.|||:...||||||:|:::.||
Zfish   207 AGLLQGGRDTCQGDSGGPMVSKQCLVWVQS-------GITSWGYGCADPYSPGVYTRVSQYQSWI 264

  Fly  1036 NQIL 1039
            |.|:
Zfish   265 NSII 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 96/247 (39%)
Tryp_SPc 798..1038 CDD:238113 98/249 (39%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 96/247 (39%)
Tryp_SPc 34..267 CDD:238113 98/249 (39%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.