DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and st14b

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:351 Identity:123/351 - (35%)
Similarity:179/351 - (50%) Gaps:44/351 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   706 KTTEAPASS---IELASSTSSYTDL--GSDLAASSSSSTTTTTSSPTTAAETTDYSGEEPNTTTI 765
            ||.|....|   |......:.|.|.  |||.:..:.|          .|...:|.:.:..|...|
Zfish   537 KTWEFRCRSGRCISAQKQCNGYNDCGDGSDESRCAKS----------IAVHCSDSTYKCKNKQCI 591

  Fly   766 EATGSTTVAPANALEGVDYKEV-CGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGA 829
            ...........:.::|.|..|. ||::.....|||||.::..|.||||:||..   .|..|.|||
Zfish   592 SKLNPMCDGETDCVDGSDEAECKCGKKPHKSSRIVGGKDSDEGEWPWQVSLHM---KTQGHVCGA 653

  Fly   830 ALLNENWAITAAHCVDNVPPSDLLLRLGEYDLAEEEEPY-GYQ---------ERRVQIVASHPQF 884
            ::::.:|.:||||||.:   :|..    .|..|::.|.| |..         :|.|..:..|||:
Zfish   654 SVISNSWLVTAAHCVQD---NDQF----RYSQADQWEVYLGLHNQGETSKSTQRSVLRIIPHPQY 711

  Fly   885 DPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENF-IGQTAFVTGWGRLYE-DGPLPSVLQEVA 947
            |..:::.|:||:....||....||.|:|:||....| .|::.::||||:|.| ...:|||||:..
Zfish   712 DHSSYDNDIALMELDSPVTLNQNIWPICLPDPTHYFPAGKSVWITGWGKLREGSDAVPSVLQKAE 776

  Fly   948 VPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISW 1012
            |.:||:|:|..:....    ..||: ||||...||.|:|:||||||| ...|.:.|..|.||:||
Zfish   777 VRIINSTVCSKLMDDG----ITPHM-ICAGVLSGGVDACQGDSGGPM-SSIEGNGRMFLAGVVSW 835

  Fly  1013 GIGCAEANQPGVYTRISEFRDWINQI 1038
            |.||...|:||||||::::|.||.:|
Zfish   836 GDGCGRRNRPGVYTRVTDYRSWIREI 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 100/249 (40%)
Tryp_SPc 798..1038 CDD:238113 101/251 (40%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060
LDLa 499..533 CDD:238060
LDLa 536..570 CDD:238060 10/32 (31%)
LDLa 578..613 CDD:238060 5/34 (15%)
Tryp_SPc 624..858 CDD:214473 100/249 (40%)
Tryp_SPc 625..861 CDD:238113 101/251 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I3236
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.