DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Prss8

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:262 Identity:92/262 - (35%)
Similarity:138/262 - (52%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 CGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTY--LHKCGAALLNENWAITAAHCVDNVPPS 850
            ||..:  :|||.||.:|..|:||||:|:      ||  .|.||.:|::..|.::||||.......
Mouse    37 CGAVI--QPRITGGGSAKPGQWPWQVSI------TYDGNHVCGGSLVSNKWVVSAAHCFPREHSR 93

  Fly   851 DLL-LRLGEYDLAEEEEPYGYQERRVQIVA---SHPQFDPRTFEYDLALLRFYEPVIFQPNIIPV 911
            :.. ::||.:.|    :.|. .:..|..||   :|..:.....:.|:||:|...||.|...|.|:
Mouse    94 EAYEVKLGAHQL----DSYS-NDTVVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSRYIRPI 153

  Fly   912 CVPDNDENF-IGQTAFVTGWGRLYEDGPL--PSVLQEVAVPVINNTICESMYRSAGYIEHIPHI- 972
            |:|..:.:| .|....|||||.:.....|  |..||::.||:|:...|..:| :...:...||. 
Mouse   154 CLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLY-NINAVPEEPHTI 217

  Fly   973 ---FICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDW 1034
               .:|||:.|||.|:|:||||||:....|.  .::|.|::|||..|...|:|||||..|.:..|
Mouse   218 QQDMLCAGYVKGGKDACQGDSGGPLSCPMEG--IWYLAGIVSWGDACGAPNRPGVYTLTSTYASW 280

  Fly  1035 IN 1036
            |:
Mouse   281 IH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 87/250 (35%)
Tryp_SPc 798..1038 CDD:238113 88/252 (35%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 88/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.