DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and XB5723326

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:289 Identity:83/289 - (28%)
Similarity:127/289 - (43%) Gaps:50/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 GEEPNTTTIEATGSTTVAPANALEGVDYKEVCGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTS 821
            |..|..|.::|:.||.:.|..                             |:|||.:|:::....
 Frog     4 GNRPFYTEVKASYSTELNPVE-----------------------------GKWPWIVSIQKKVEL 39

  Fly   822 TYLHKCGAALLNENWAITAAHCV----DNVPPSDLLLRLGEYDLAEEEEPYGY--QERRVQIVAS 880
            .|.|.|...:||..|.||||||.    :..|.:.|.:.||.:.|:|    .|.  |.|.|:.:..
 Frog    40 GYKHICAGTILNNEWIITAAHCFKDWKEGDPTTPLRVLLGTFYLSE----IGLRTQSRGVKQLIK 100

  Fly   881 HPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDND---ENFIGQTAFVTGWGRLYEDGPLPS- 941
            |.|:||.|...|:||::..:.|.|..:|...|.|...   ::.|  ...:.|||...:....|| 
 Frog   101 HDQYDPITESNDIALIQLDKQVEFSDHIQQACFPKESADLKDLI--DCSIAGWGAQGKHLDEPSQ 163

  Fly   942 VLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHL 1006
            .|||..|..|:...|...|:......|     :|||.:||...:|.||.|.|::.:.:.:..:.:
 Frog   164 FLQEAQVERIDTKHCNKWYQGILGENH-----LCAGHRKGPEKTCNGDRGSPLMCRTKKNNVYSV 223

  Fly  1007 GGVISWGIGCAEANQPGVYTRISEFRDWI 1035
            .|:::||.||.:...||||:.|.....||
 Frog   224 IGILNWGSGCGQTRSPGVYSPIQSHIKWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 74/247 (30%)
Tryp_SPc 798..1038 CDD:238113 76/248 (31%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.