DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Tmprss6

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_082178.2 Gene:Tmprss6 / 71753 MGIID:1919003 Length:811 Species:Mus musculus


Alignment Length:287 Identity:103/287 - (35%)
Similarity:152/287 - (52%) Gaps:26/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 EEPNTTTIEATGSTTVAPANALEGVDYKEV-CGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTS 821
            ::||.   |..|.     ::..:|.|.:.. ||.:.. ..|||||..::.|.||||.|| |.|..
Mouse   545 KKPNP---ECDGQ-----SDCRDGSDEQHCDCGLQGL-SSRIVGGTVSSEGEWPWQASL-QIRGR 599

  Fly   822 TYLHKCGAALLNENWAITAAHCVDN---VPPSDLLLRLGEYDLAEEEEPYGYQERRVQIVASHPQ 883
               |.||.||:.:.|.||||||...   ..|....:.||:  :.:.....|....:|..:..||.
Mouse   600 ---HICGGALIADRWVITAAHCFQEDSMASPKLWTVFLGK--MRQNSRWPGEVSFKVSRLFLHPY 659

  Fly   884 FDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENF-IGQTAFVTGWGRLYEDGPLPSVLQEVA 947
            .:..:.:||:|||:...||::...:.|||:|.....| .||..::||||...|.||:.:.||:|.
Mouse   660 HEEDSHDYDVALLQLDHPVVYSATVRPVCLPARSHFFEPGQHCWITGWGAQREGGPVSNTLQKVD 724

  Fly   948 VPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISW 1012
            |.::...:|...||     ..:....:|||::||..|:|:||||||:|. ||...|:.|.|::||
Mouse   725 VQLVPQDLCSEAYR-----YQVSPRMLCAGYRKGKKDACQGDSGGPLVC-REPSGRWFLAGLVSW 783

  Fly  1013 GIGCAEANQPGVYTRISEFRDWINQIL 1039
            |:||...|..|||||::...:||.|:|
Mouse   784 GLGCGRPNFFGVYTRVTRVINWIQQVL 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 91/241 (38%)
Tryp_SPc 798..1038 CDD:238113 92/243 (38%)
Tmprss6NP_082178.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486 6/28 (21%)
Tryp_SPc 576..806 CDD:214473 91/241 (38%)
Tryp_SPc 577..809 CDD:238113 92/243 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8807
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.