DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and TMPRSS2

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:509 Identity:133/509 - (26%)
Similarity:187/509 - (36%) Gaps:148/509 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   629 PSNWLPLTTESSETADKTSASTAPPSATDKVVISVATSVSEVETHGPGKPQKTTKPPKPSSTAKP 693
            |.|..|.......|..:...:...||...:....|.|..|        .|...|:|..||.|...
Human    59 PENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQAS--------NPVVCTQPKSPSGTVCT 115

  Fly   694 TTTTTAAATTIVKTT------------------EAPASSIELASS-----TSSYTDLGSDLAASS 735
            :.|..|...|:...|                  :...|.||..||     .|::.|..|......
Human   116 SKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE 180

  Fly   736 SSSTTTTTSSPTTAAETTDYSGEE------------------------------PNTTTIEATGS 770
            ..:.......|....:.  ||.:.                              .:...::.:||
Human   181 DENRCVRLYGPNFILQV--YSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGS 243

  Fly   771 TTVAPANALEG-VD-YKEV------------------CGRRM--FPEPRIVGGANAAFGRWPWQI 813
            |:....|...| || ||::                  ||..:  ..:.|||||.:|..|.||||:
Human   244 TSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQV 308

  Fly   814 SLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEYDLAEEEEPY---------- 868
            ||....    :|.||.:::...|.:||||||                    |:|.          
Human   309 SLHVQN----VHVCGGSIITPEWIVTAAHCV--------------------EKPLNNPWHWTAFA 349

  Fly   869 ------------GYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPD-----N 916
                        |||   |:.|.|||.:|.:|...|:||::..:|:.|...:.|||:|:     .
Human   350 GILRQSFMFYGAGYQ---VEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQ 411

  Fly   917 DENFIGQTAFVTGWGRLYEDGPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKG 981
            .|    |..:::|||...|.|....||....|.:|....|.|.|   .|...|....||||:.:|
Human   412 PE----QLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRY---VYDNLITPAMICAGFLQG 469

  Fly   982 GYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWI 1035
            ..|||:||||||:|..:  :..:.|.|..|||.|||:|.:||||..:..|.|||
Human   470 NVDSCQGDSGGPLVTSK--NNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 90/264 (34%)
Tryp_SPc 798..1038 CDD:238113 91/265 (34%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625 6/31 (19%)
LDLa 150..185 CDD:238060 8/34 (24%)
SRCR_2 190..283 CDD:292133 13/94 (14%)
Tryp_SPc 292..521 CDD:214473 90/264 (34%)
Tryp_SPc 293..524 CDD:238113 91/265 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40690
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.