DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:104 Identity:43/104 - (41%)
Similarity:63/104 - (60%) Gaps:11/104 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   940 PSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRF 1004
            |..||:..|||:.|:.|.::..:.     |....:|||..:||.|:|:||||||||.|:.|  .:
Zfish    13 PRTLQQTVVPVVINSDCNNLLGAT-----ITDNMMCAGLLQGGKDTCQGDSGGPMVSQQCS--VW 70

  Fly  1005 HLGGVISWGIGCAEANQPGVYTRISEFRDW----INQIL 1039
            ...|:||.|..|.:..:||||||:|::::|    |||.|
Zfish    71 VQSGIISKGHDCGQPYEPGVYTRVSQYQNWIMSSINQNL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 39/98 (40%)
Tryp_SPc 798..1038 CDD:238113 41/101 (41%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 39/96 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.