DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and tmprss5

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:282 Identity:109/282 - (38%)
Similarity:155/282 - (54%) Gaps:30/282 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   769 GSTTVAPANALEGVDYKEVCGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYL---HKCGAA 830
            ||.:.....||:..:    ||.|. ..|||:||..||.||||||:||       |.   |.||.:
Zfish   288 GSCSTGKVIALKCFE----CGTRA-KLPRIIGGVEAALGRWPWQVSL-------YYNNRHICGGS 340

  Fly   831 LLNENWAITAAHCVDN-----VPPSDLLLRLGEYDLAEEEEPYGYQERRVQIVASHPQFDPRTFE 890
            ::...|.:||||||.|     ||...:...:...:||:..:   ||...|:.:..:..::.||.:
Zfish   341 IITNQWIVTAAHCVHNYRLPQVPSWVVYAGIITSNLAKLAQ---YQGFAVERIIYNKNYNHRTHD 402

  Fly   891 YDLALLRFYEPVIFQPNIIPVCVPDNDENFIGQT-AFVTGWGRLYEDGPL-PSVLQEVAVPVINN 953
            .|:||::...|:.|...|.|||:|..|.:..|.| .:::|||....|..| |.||:|..||:|:.
Zfish   403 NDIALVKLKTPLNFSDTIRPVCLPQYDHDLPGGTQCWISGWGYTQPDDVLIPEVLKEAPVPLIST 467

  Fly   954 TICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAE 1018
            ..|.|   |..|...|....:|||:.:|..|:|:||||||:|.|.|:..|  |.||:|||.||||
Zfish   468 KKCNS---SCMYNGEITSRMLCAGYSEGKVDACQGDSGGPLVCQDENVWR--LVGVVSWGTGCAE 527

  Fly  1019 ANQPGVYTRISEFRDWINQILQ 1040
            .|.||||::::||..||..|::
Zfish   528 PNHPGVYSKVAEFLGWIYDIIE 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 98/247 (40%)
Tryp_SPc 798..1038 CDD:238113 99/249 (40%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 6/21 (29%)
Tryp_SPc 311..544 CDD:214473 98/247 (40%)
Tryp_SPc 312..547 CDD:238113 99/249 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25354
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.