DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and hpn

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_001091657.2 Gene:hpn / 569259 ZFINID:ZDB-GENE-141212-373 Length:425 Species:Danio rerio


Alignment Length:402 Identity:124/402 - (30%)
Similarity:178/402 - (44%) Gaps:95/402 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 AATTIVKTTE----------APASSIELASST---------SSYTDLGSDLAASSSSSTTTTTSS 745
            |..|.::|||          |....:.:..||         ||...|.:::.............|
Zfish    41 ALVTYLRTTEDTGLFDVQVSAADQRLRVFDSTQWRWKYVCSSSVNQLIANITCEEMGFVRAVNFS 105

  Fly   746 PTTAAET---TDYSGEEPNTTTIEATGSTTVAPANALEGVDYKEV---CGRRMFPEPRIVGGANA 804
            .|.|.|:   .|:...:.:..|......|.:.|....:|...:.:   |||||.||.|||||.:|
Zfish   106 VTCAPESGGDRDFFCVKESELTYGKKIKTALYPCKCDKGQILEVICQDCGRRMLPEERIVGGVDA 170

  Fly   805 AFGRWPWQISLRQWRTSTY--LHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEYDLAEEEEP 867
            ..|.||||:||:      |  :|:||.:::::.|.|:||||.                    .|.
Zfish   171 RQGSWPWQVSLQ------YDGVHQCGGSIISDRWIISAAHCF--------------------PER 209

  Fly   868 YGYQER--------------------RVQIVASHPQFDPRTF--------EYDLALLRFYEPVIF 904
            |.:..|                    .|:.|..|..:.|  |        ..|:|::...:|:.|
Zfish   210 YRHASRWRVLMGSIYNTPIRKNVVIAEVKTVVYHSSYLP--FVDANIDDNSRDIAVISLTKPLQF 272

  Fly   905 QPNIIPVCVPDNDENFI-GQTAFVTGWGRLYEDGPLPSVLQEVAVPVINNTICESM-YRSAGYIE 967
            ...|.|||:|...:... ||...|||||.:...|...:||||..||:|::.:|... |    |..
Zfish   273 TDYIQPVCLPTYGQRLADGQMGTVTGWGNVEYYGTQANVLQEAHVPIISDAVCNGPDY----YDN 333

  Fly   968 HIPHIFICAGWKKGGYDSCEGDSGGPM----VLQRESDKRFHLGGVISWGIGCAEANQPGVYTRI 1028
            .:.....|||::|||.|||:||||||.    ||.:.|  |:.|.||:|||.|||.|.:||||||:
Zfish   334 QVTTTMFCAGYEKGGTDSCQGDSGGPFVAADVLSKTS--RYRLLGVVSWGTGCAMAKKPGVYTRV 396

  Fly  1029 SEFRDWINQILQ 1040
            |.|..||:..::
Zfish   397 SRFLPWISTAMR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 95/273 (35%)
Tryp_SPc 798..1038 CDD:238113 96/275 (35%)
hpnNP_001091657.2 SRCR_2 54..160 CDD:321960 20/105 (19%)
Tryp_SPc 164..404 CDD:238113 95/273 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.