DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and TMPRSS4

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:370 Identity:102/370 - (27%)
Similarity:172/370 - (46%) Gaps:75/370 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 EAPASSIELASSTSSYTDLGSDLAAS---SSSSTTTTTSSPTTAAETTDYSGEEPNTTTIEATGS 770
            |.||.::.|:...|:...|  |.|..   |:.....|.:...||.....|| .:|....:|    
Human    98 EGPAVAVRLSKDRSTLQVL--DSATGNWFSACFDNFTEALAETACRQMGYS-SKPTFRAVE---- 155

  Fly   771 TTVAPANALEGVDYKE-------------------------VCGRRMFPEPRIVGGANAAFGRWP 810
              :.|...|:.|:..|                         .||:.: ..||:||...|:...||
Human   156 --IGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSL-KTPRVVGVEEASVDSWP 217

  Fly   811 WQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPP---------SDLLLRLGEY-DLAEEE 865
            ||:|::..:.    |.||.::|:.:|.:|||||......         ||   :||.: .||   
Human   218 WQVSIQYDKQ----HVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSD---KLGSFPSLA--- 272

  Fly   866 EPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENFIGQT-AFVTG 929
                  ..::.|:..:|.: |:  :.|:||::...|:.|...:.|:|:|..||.....| .::.|
Human   273 ------VAKIIIIEFNPMY-PK--DNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIG 328

  Fly   930 WGRLYED-GPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGP 993
            ||...:: |.:..:|.:.:|.||::|.|.:   ...|...:....:|||..:||.|:|:||||||
Human   329 WGFTKQNGGKMSDILLQASVQVIDSTRCNA---DDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGP 390

  Fly   994 MVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWINQI 1038
            ::.|.:   ::|:.|::|||.||...:.|||||::|.:.:||..:
Human   391 LMYQSD---QWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 77/249 (31%)
Tryp_SPc 798..1038 CDD:238113 78/251 (31%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 16/97 (16%)
Tryp_SPc 204..429 CDD:214473 77/249 (31%)
Tryp_SPc 205..432 CDD:238113 78/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.