DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and tmprss13a

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_001152984.1 Gene:tmprss13a / 559754 ZFINID:ZDB-GENE-090309-3 Length:506 Species:Danio rerio


Alignment Length:334 Identity:104/334 - (31%)
Similarity:160/334 - (47%) Gaps:46/334 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 SYTD-----LGSDLAASSSSSTTTTTSSPTTAAETTDYSGEEPNTTTIEATGSTTVAPANALEG- 781
            ||.|     ||  ...|..||...:.||.....|.|              :|......||...| 
Zfish   199 SYADQICEQLG--FRRSYESSALNSKSSEALILEPT--------------SGLLIQGLANVSSGC 247

  Fly   782 VDYKEV------CGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITA 840
            :|.|.|      ||::. ...||:||..:..|::|||:||...:.    |.||..|::.::.::|
Zfish   248 LDDKSVSLQCSDCGKQQ-SSSRIIGGTTSELGQYPWQVSLHYNKA----HVCGGTLISPDFIVSA 307

  Fly   841 AHCVDNVPPSDL--LLRLGEYDLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVI 903
            |||......:..  |:.:|.........||..:    :|:.|. :::..|.:.|:|||....||.
Zfish   308 AHCFQGKMANSAYWLVYVGIVSQQSLGMPYLVK----KIIVSE-KYNSDTNDNDVALLILSRPVA 367

  Fly   904 FQPNIIPVCVPDNDENFI-GQTAFVTGWGRLYEDGP-LPSVLQEVAVPVINNTICESMYRSAGYI 966
            |.....|||:|..::.|. |...:.:|:|...:... ..|.|..|:|.:|::::|.|.....|. 
Zfish   368 FSYTTQPVCLPTFNQTFSGGLQCWTSGFGTTKQGADRASSSLMSVSVNIIDSSVCNSCQIYCGL- 431

  Fly   967 EHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEF 1031
              |.:..||||..|||.|||:||||||:|. ::.:.|::|.|:.|||.||.:..:||||:|::.|
Zfish   432 --ITNNMICAGDLKGGRDSCQGDSGGPLVC-KDDNNRWYLVGITSWGAGCGQKQKPGVYSRVTSF 493

  Fly  1032 RDWINQILQ 1040
            ..||...:|
Zfish   494 LPWIYTKMQ 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 80/241 (33%)
Tryp_SPc 798..1038 CDD:238113 81/243 (33%)
tmprss13aNP_001152984.1 SRCR_2 178..261 CDD:295335 19/77 (25%)
Tryp_SPc 268..497 CDD:214473 80/241 (33%)
Tryp_SPc 269..497 CDD:238113 79/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.