DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and proz

DIOPT Version :10

Sequence 1:NP_610437.2 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_001116189.1 Gene:proz / 496781 XenbaseID:XB-GENE-971425 Length:416 Species:Xenopus tropicalis


Alignment Length:247 Identity:46/247 - (18%)
Similarity:79/247 - (31%) Gaps:87/247 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PVLRSLYIDDNALTELPTHWGKLPNLV-------------------------------------Y 187
            |:|..:..|.|....:|..|....|:|                                     .
 Frog   121 PLLNEIKEDTNKWKNIPCSWVGRINIVKMAILPKGRDLDDKIQEYKQAGKIFPENQIIEWFIQLL 185

  Fly   188 LGFDRNYLKRI---DISFFGKFPTLNAIFICENNVE----------TIRTSTPITM-PE------ 232
            ||.|..:.:||   |:.....|...|.:.|.:..|.          |..|.||..| ||      
 Frog   186 LGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQG 250

  Fly   233 ---------LDIMLFESNQIVSVN--FTGCNFPKMNIISLMNNRLTTIPPLFQRFSESRLTMEG- 285
                     |..:|:|   :..:|  |.|.||..: ::.::.....::|..:.:  |....||. 
 Frog   251 YDTKSDIWSLACILYE---MCCMNHAFAGSNFLSI-VLKIVEGDTPSLPERYPK--ELNAIMESM 309

  Fly   286 ---NP-IKCCNMTVFKSKITDFQLR--------VTTGTTQSDCPTTSSIVLD 325
               || ::...:.:.|....|.||:        :|......||...::.:::
 Frog   310 LNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIIN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_610437.2 Tryp_SPc 798..1038 CDD:238113
prozNP_001116189.1 GLA 22..85 CDD:214503
EGF_CA 92..123 CDD:238011 1/1 (100%)
FXa_inhibition 136..167 CDD:464251 4/30 (13%)
Tryp_SPc 197..414 CDD:473915 33/171 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.