DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and tmprss2

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_001008623.1 Gene:tmprss2 / 494080 ZFINID:ZDB-GENE-041212-48 Length:486 Species:Danio rerio


Alignment Length:292 Identity:111/292 - (38%)
Similarity:147/292 - (50%) Gaps:33/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   755 YSGEE----PNTTTIEATGSTTVAPANALEGVDYKEVCGRRMFPEPRIVGGAN-AAFGRWPWQIS 814
            |||.:    |:...|.|..|:|   |.:|:..|    |||.  ...|||||.. .:.|.||||:|
Zfish   214 YSGYQGILSPSLDFISACQSST---AVSLKCTD----CGRS--TGNRIVGGTTVTSKGVWPWQVS 269

  Fly   815 LRQWRTSTYLHKCGAALLNENWAITAAHCVDNVP-PSDLLLRLGEYDLAEEEEPYGYQERRVQIV 878
            |..    :..|.||.:::...|.:||||||.... |....:..|....:|.....|....|:.| 
Zfish   270 LHY----SGRHLCGGSIITPYWILTAAHCVHQFSNPGGWTVYAGYLTQSEMASASGNSVNRIVI- 329

  Fly   879 ASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENFIG-QTAFVTGWGRLYEDGPLPSV 942
              | .|:|.|.|.|:||:|....:....||.|||:|:...:|.. |..:|||||.|:..|...:.
Zfish   330 --H-DFNPNTNENDIALMRLNTALTISTNIRPVCLPNKGMSFTAQQDCYVTGWGALFSGGSSSAT 391

  Fly   943 LQEVAVPVINNTICES--MYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFH 1005
            |||..:.:|::|||.|  :|...     |....||||...||.|||:||||||:|....|  .:.
Zfish   392 LQEAKIQLIDSTICNSRPVYNGL-----ITDTMICAGKLAGGVDSCQGDSGGPLVTNVRS--LWW 449

  Fly  1006 LGGVISWGIGCAEANQPGVYTRISEFRDWINQ 1037
            |.|..|||.|||..|:||||..::.|.|||.|
Zfish   450 LLGDTSWGDGCAVRNKPGVYGNVTYFLDWIYQ 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 94/242 (39%)
Tryp_SPc 798..1038 CDD:238113 96/245 (39%)
tmprss2NP_001008623.1 LDLa 132..168 CDD:238060
SRCR_2 173..248 CDD:295335 14/42 (33%)
Tryp_SPc 251..479 CDD:214473 94/242 (39%)
Tryp_SPc 252..482 CDD:238113 96/245 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.