DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Tmprss9

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:463 Identity:130/463 - (28%)
Similarity:191/463 - (41%) Gaps:131/463 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   583 PLITTEPPTSAPLTTTTKKTGLITW--TDVEAEPP---TNASISNDWQPAPPSNWLPLTTESSET 642
            ||:..||.....|      .|:::|  ...||..|   |..:...||           ..|.:..
Mouse   643 PLVCEEPSGRFFL------AGIVSWGIGCAEARRPGVYTRVTRLRDW-----------ILEVTSA 690

  Fly   643 ADKTSASTAPPSATDKVVISVATSVSEVETHGPGKPQKTTKPPKPSSTAKPTTTTTAAATTIVKT 707
            ||.....||.|:                              |...||..||:..:.|..|..|.
Mouse   691 ADMPVVPTATPA------------------------------PATPSTPWPTSPESWAPNTFAKP 725

  Fly   708 TEAPASSIELASSTSSYTDLGSDLAASSSSSTTTTTSSPTTAAETTDYSGEEPNTTTIEATGSTT 772
            |.||                                 ||                  :....|||
Mouse   726 TAAP---------------------------------SP------------------VPLHPSTT 739

  Fly   773 VAPANALEGVDYKEVCGRR--MFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNEN 835
            ..|          :.||.|  |....|||||.:|..|..|||.||::...    |.|||.::.:.
Mouse   740 AKP----------QECGARPAMDKPTRIVGGISAVSGEVPWQASLKEGPR----HFCGATVVGDR 790

  Fly   836 WAITAAHCVDNVPPSDLLLRLGEYD-LAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFY 899
            |.::||||.::.....:...||... |.....|.....||   ||.||:::|...::|:|||...
Mouse   791 WLLSAAHCFNHTKVEQVQAHLGTVSLLGVGGSPVKLGLRR---VALHPRYNPGILDFDVALLELA 852

  Fly   900 EPVIFQPNIIPVCVPDNDENF-IGQTAFVTGWGRLYE-DGPLPSVLQEVAVPVINNTICESMYRS 962
            :|::|...|.|||:|.....| :|:...::|||.:.| :...|.:||:.:|.:|...:|.::|..
Mouse   853 QPLVFNKYIQPVCLPLAIHKFPVGRKCMISGWGNMQEGNATKPDILQKASVGIIEQKMCGALYNF 917

  Fly   963 AGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTR 1027
            :     :....:|||:.:|..|||:||||||:..: |:...|:|.|::|||||||:|.:||||.|
Mouse   918 S-----LTDRMLCAGFLEGRVDSCQGDSGGPLACE-ETPGVFYLAGIVSWGIGCAQAKKPGVYAR 976

  Fly  1028 ISEFRDWI 1035
            |:..:|||
Mouse   977 ITRLKDWI 984

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 88/240 (37%)
Tryp_SPc 798..1038 CDD:238113 89/241 (37%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473 13/57 (23%)
Tryp_SPc 756..984 CDD:214473 88/240 (37%)
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.