DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and CG11836

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:249 Identity:91/249 - (36%)
Similarity:138/249 - (55%) Gaps:18/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   795 EPRIVGGANAAFGRWPWQISLRQWRTSTYLHK--CGAALLNENWAITAAHCVDNVPPSDLLLRLG 857
            |.|||||......::||...:      .|..|  ||.:||.:::.::|||||..:..|.:.:..|
  Fly    94 EIRIVGGKPTGVNQYPWMARI------VYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFG 152

  Fly   858 EYDLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENFIG 922
            ::|.....|....| |.|..|..|..|||.|:..|:||||..:|:.|...|.|:|:|..:.:..|
  Fly   153 DHDQEITSESQAIQ-RAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAG 216

  Fly   923 QTAFVTGWGRLYEDGPLPSVLQEVAVPVINNTICESM-YRSAGYIEHIPHIFICAGWKKGGYDSC 986
            :...|.||||..|.|.|||::.:|.||:::.|.|.:. |:|.    .|....:|||  :...|||
  Fly   217 RIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKST----RITSSMLCAG--RPSMDSC 275

  Fly   987 EGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWINQILQ 1040
            :||||||::|  .:..::.:.|::|||:||.....||||:|:|:|..||...|:
  Fly   276 QGDSGGPLLL--SNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 87/240 (36%)
Tryp_SPc 798..1038 CDD:238113 88/242 (36%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.810

Return to query results.
Submit another query.