DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and CG1299

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:414 Identity:129/414 - (31%)
Similarity:186/414 - (44%) Gaps:57/414 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   668 SEVETHGPGKPQKTTKPPKPSSTAKPTTTTTAAATT---IVKTTEA----------------PAS 713
            ||....||..|.:.  |..|.....|.||||...||   |..|:.|                |.:
  Fly   111 SESTFIGPQPPPEV--PDNPFLIPTPRTTTTTTTTTPAPIPDTSAAPLIEPRGTVCRGPDTKPGN 173

  Fly   714 SIELASSTSSYTDLGSDLAASSSSSTTTTTSSPTTAAETTDYSGEEPNTTTIEATGSTTVAPANA 778
            .:|:....|...:|      .|.|...|..:....:.......|.:....|.:...:||.||:..
  Fly   174 CVEIKECASLLNEL------RSRSQDATFANFLRASNAVCQNKGTQVCCPTGQGITNTTPAPSQI 232

  Fly   779 LEG---------VDYKEVCGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNE 834
            :..         ::.:|.||..:....:||||..:..|.|||...|.....|....|||..|:..
  Fly   233 VPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITA 297

  Fly   835 NWAITAAHCVDNVPPSDL-LLRLGEYDLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRF 898
            ...:|||||:    ..|| .:||||:||:.:.|. |:.:..:....|||.::.|....|:|:|..
  Fly   298 RHVLTAAHCI----RQDLQFVRLGEHDLSTDTET-GHVDINIARYVSHPDYNRRNGRSDMAILYL 357

  Fly   899 YEPVIFQPNIIPVCVPD----NDENFIGQTAFVTGWGRLYEDGPLPSVLQEVAVPVINNTIC--- 956
            ...|.|...|.|:|:|.    ..::::|...||.|||:..|.|....||.|:.:|:.:|.:|   
  Fly   358 ERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQS 422

  Fly   957 ---ESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQR--ESDKRFHLGGVISWGIGC 1016
               |..|.||   :......:|||...||.|:|:||||||::|..  :...||:|.||:|:||||
  Fly   423 YAKEKRYFSA---DQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGC 484

  Fly  1017 AEANQPGVYTRISEFRDWINQILQ 1040
            |..|.||||:....|.|||.|.:|
  Fly   485 ARPNVPGVYSSTQYFMDWIIQQVQ 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 92/250 (37%)
Tryp_SPc 798..1038 CDD:238113 94/252 (37%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 8/57 (14%)
Tryp_SPc 260..503 CDD:214473 92/250 (37%)
Tryp_SPc 261..503 CDD:238113 92/249 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.