DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and KLKB1

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:389 Identity:110/389 - (28%)
Similarity:177/389 - (45%) Gaps:81/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 IVKTTEA--PASSIELASSTSSYTDLGSDLAASSSSSTTTTTSSPTTAAETTDYSGEEPNTTTIE 766
            ::||:|:  |:||....::.|.|:.|        :...|......:......|:.|||.|.|.::
Human   268 LLKTSESGTPSSSTPQENTISGYSLL--------TCKRTLPEPCHSKIYPGVDFGGEELNVTFVK 324

  Fly   767 AT---------------------------------------GSTTVAPANALEGVDY-------- 784
            ..                                       ||.|...........|        
Human   325 GVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTG 389

  Fly   785 -KEVCGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVP 848
             ..||..:  ...|||||.|:::|.||||:|| |.:.:...|.||.:|:...|.:|||||.|.:|
Human   390 DNSVCTTK--TSTRIVGGTNSSWGEWPWQVSL-QVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLP 451

  Fly   849 PSDL------LLRLGEYDLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPN 907
            ..|:      :|.|.:   ..::.|:.    :::.:..|..:......:|:||::...|:.:...
Human   452 LQDVWRIYSGILNLSD---ITKDTPFS----QIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEF 509

  Fly   908 IIPVCVPD-NDENFIGQTAFVTGWGRLYEDGPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPH 971
            ..|:|:|. .|.:.|....:|||||...|.|.:.::||:|.:|::.|..|:..|:.    ..|..
Human   510 QKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQD----YKITQ 570

  Fly   972 IFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWI 1035
            ..:|||:|:||.|:|:||||||:|.:...  .:.|.|:.|||.|||...||||||:::|:.|||
Human   571 RMVCAGYKEGGKDACKGDSGGPLVCKHNG--MWRLVGITSWGEGCARREQPGVYTKVAEYMDWI 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 86/244 (35%)
Tryp_SPc 798..1038 CDD:238113 87/245 (36%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519 9/34 (26%)
APPLE 303..386 CDD:128519 10/82 (12%)
Tryp_SPc 401..632 CDD:214473 86/244 (35%)
Tryp_SPc 402..632 CDD:238113 85/243 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.