DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Tmprss4

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:375 Identity:106/375 - (28%)
Similarity:171/375 - (45%) Gaps:50/375 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   675 PGKPQKTTKPPKPSSTAK--PTTTTTAAATTIVKTTEAPASSIELASSTSSYTDLGSDLAASSSS 737
            |.||..|.:..|..||.:  .....|.|:......|||.|.:   |.....|         :|..
  Rat   138 PEKPGVTVRLSKDRSTLQVLDAARGTWASVCFDNFTEALAKT---ACRQMGY---------NSQP 190

  Fly   738 STTTTTSSPTTAAETTDYSGEEPNTTTIEATGSTTVAPANALEGVDYKEVCGRRMFPEPRIVGGA 802
            :.......|......|..:|..........:.|.......:|..:|    ||:.: ...|:|||.
  Rat   191 AFGPVEMGPNQTLLVTPVTGNSQELQMQNGSRSCLSGSLVSLRCLD----CGKSL-KTTRVVGGV 250

  Fly   803 NAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDN-VPPSDLLLRLGEYDLAEEEE 866
            .|:...||||:|::..:.    |.||.::|:.:|.:|||||... :..|...:|.|...|.....
  Rat   251 EASADSWPWQVSIQYNKQ----HVCGGSILDHHWILTAAHCFRKYLDVSSWKVRAGSNKLGNSPS 311

  Fly   867 -PYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENFI-GQTAFVTG 929
             |..    ::.|...:| ..|:  |.|:||::...|:.|..::.|:|:|.:||..| ....:|.|
  Rat   312 LPVA----KIFIAEPNP-LQPK--EKDIALVKLKMPLTFSGSVRPICLPFSDEELIPTMPVWVIG 369

  Fly   930 WGRLYED-GPLPSVLQEVAVPVINNTIC--ESMYR---SAGYIEHIPHIFICAGWKKGGYDSCEG 988
            ||...|: |.:...|.:.:|.||::..|  |..|:   :||        .:|||..:||.|:|:|
  Rat   370 WGFTEENGGKMSDTLLQASVQVIDSARCNAEDAYQGEVTAG--------MLCAGTPQGGKDTCQG 426

  Fly   989 DSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWINQI 1038
            |||||::...:   ::.:.|::|||.||...:.|||||:::.:.|||..:
  Rat   427 DSGGPLMYHYD---KWQVVGIVSWGYGCGSPSTPGVYTKVTAYLDWIYNV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 80/246 (33%)
Tryp_SPc 798..1038 CDD:238113 81/248 (33%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346 18/104 (17%)
Tryp_SPc 245..470 CDD:214473 80/246 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.