DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and TMPRSS9

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:422 Identity:132/422 - (31%)
Similarity:189/422 - (44%) Gaps:69/422 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   644 DKTSASTAPPSATDKV--------VISVATSVSEVETHGPGKPQKTTK-----------PPKPSS 689
            |.....:..|.|.::.        ::|.....::|:.  ||...:.|:           .|.|.|
Human   715 DSCQGDSGGPLACEEAPGVFYLAGIVSWGIGCAQVKK--PGVYTRITRLKGWILEIMSSQPLPMS 777

  Fly   690 TAKPTTTTTAAATTIVKTTEAPASSIELASSTSSYTDLGSDLAASSSSSTTTTTSSPTTAAETTD 754
               |.:||...|||..:||    :.:.:..:|.|....|      ::|..|...::.|.:|.:|.
Human   778 ---PPSTTRMLATTSPRTT----AGLTVPGATPSRPTPG------AASRVTGQPANSTLSAVSTT 829

  Fly   755 YSGEEPNTTTIEATGSTTVAPANALEGVDYKEVCGRRMFPEPRIVGGANAAFGRWPWQISLRQWR 819
            ..|:.|.....|||..|.:..            ||.......|||||:.|..|.||||:||...|
Human   830 ARGQTPFPDAPEATTHTQLPD------------CGLAPAALTRIVGGSAAGRGEWPWQVSLWLRR 882

  Fly   820 TSTYLHKCGAALLNENWAITAAHCVDNV-PPSDLLLRLGEYDLAEEEEPYGYQERRVQIVASHPQ 883
            ..   |:|||.|:.|.|.::||||.|.. .|......||...|:..|.    |..||..:..||.
Human   883 RE---HRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGAEG----QLERVARIYKHPF 940

  Fly   884 FDPRTFEYDLALLRFYEPVIFQPNIIPVCVPD-----NDENFIGQTAFVTGWGRLYEDGPLPSVL 943
            ::..|.:||:|||....||.....:.|:|:|:     .|    |....:||||.:.|.|.:...|
Human   941 YNLYTLDYDVALLELAGPVRRSRLVRPICLPEPAPRPPD----GTRCVITGWGSVREGGSMARQL 1001

  Fly   944 QEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGG 1008
            |:.||.:::...|...|.     ..|....:|||:.:||.|||.||:|||:.. ||...|:.|.|
Human  1002 QKAAVRLLSEQTCRRFYP-----VQISSRMLCAGFPQGGVDSCSGDAGGPLAC-REPSGRWVLTG 1060

  Fly  1009 VISWGIGCAEANQPGVYTRISEFRDWINQILQ 1040
            |.|||.||...:.||||||::..|.||.|.:|
Human  1061 VTSWGYGCGRPHFPGVYTRVAAVRGWIGQHIQ 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 93/243 (38%)
Tryp_SPc 798..1038 CDD:238113 94/245 (38%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.