DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and prss60.3

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:263 Identity:97/263 - (36%)
Similarity:141/263 - (53%) Gaps:34/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   787 VCGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSD 851
            |||:... ..|||||.||:.|.||||:||...:...  |.||.:|::..|.:|||||:..|..:.
Zfish    26 VCGQAPL-NTRIVGGVNASPGSWPWQVSLHSPKYGG--HFCGGSLISSEWVLTAAHCLSGVSETT 87

  Fly   852 LLLRLGEYDLAEEEEPYGYQERRVQIVAS--HPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCV- 913
            |::.||.    ..::.....|....:..|  |..::..|.:.|:||||....|.|...|.|||: 
Zfish    88 LVVYLGR----RTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLA 148

  Fly   914 PDNDENFIGQTAFVTGWGRLYEDG---PLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFIC 975
            ..|.....|.::::||||.: :.|   |.|.:|||..:||:.|..|.::..|.    .:.:..||
Zfish   149 AQNSVYSAGTSSWITGWGDI-QAGVNLPAPGILQETMIPVVANDRCNALLGSG----TVTNNMIC 208

  Fly   976 AGWKKGGYDSCEGDSGGPMV-------LQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRD 1033
            ||..:||.|:|:||||||||       :|         .|:.|||.|||:.|.||||||:|:::.
Zfish   209 AGLTQGGKDTCQGDSGGPMVTRLCTVWVQ---------AGITSWGYGCADPNSPGVYTRVSQYQS 264

  Fly  1034 WIN 1036
            ||:
Zfish   265 WIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 92/250 (37%)
Tryp_SPc 798..1038 CDD:238113 93/252 (37%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 93/252 (37%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.