DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Tmprss9

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:346 Identity:115/346 - (33%)
Similarity:175/346 - (50%) Gaps:57/346 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   698 TAAATTIVKTTEAPASSIELASSTSSYTDLGSDLAASSSSSTTTTTSSPTTAAETTDYSGEEPNT 762
            |::|.|.|..|||||                         ..|.:|..||:.      ....|||
  Rat   471 TSSADTPVVPTEAPA-------------------------PITPSTPWPTSP------ESRVPNT 504

  Fly   763 TTIEATGSTTVAPANALEGVDYKEVCGRR--MFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLH 825
            |. :.|.:.|.||.:.......:| ||.|  |....|||||.:|..|..|||.||::...    |
  Rat   505 TA-KPTVAPTPAPLHPSTAAKPQE-CGARPAMDKPTRIVGGISAVSGEVPWQASLKEGSR----H 563

  Fly   826 KCGAALLNENWAITAAHCVDNVPPSDLLLRLGEYDLAEEEEPYGYQERRVQI----VASHPQFDP 886
            .|||.::.:.|.::||||.::.....:...||...|      .|.....|::    ||.||:::|
  Rat   564 FCGATVVGDRWLLSAAHCFNHTKLEQVQAHLGTVSL------LGVGGSPVKLGLRSVALHPRYNP 622

  Fly   887 RTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENF-IGQTAFVTGWGRLYE-DGPLPSVLQEVAVP 949
            ...::|:|||...:|::|...|.|||:|.....| :|:...::|||.:.| :...|.:||:.:|.
  Rat   623 GILDFDVALLELAQPLVFNKYIQPVCLPLAIHKFPVGRKCMISGWGNMQEGNATKPDILQKASVG 687

  Fly   950 VINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGI 1014
            :|...:|.::|..:     :....:|||:.:|..|||:||||||:..: |:...|:|.|::||||
  Rat   688 IIEQKMCGALYNFS-----LTDRMLCAGFLEGRVDSCQGDSGGPLACE-ETPGVFYLAGIVSWGI 746

  Fly  1015 GCAEANQPGVYTRISEFRDWI 1035
            |||:|.:||||.||:..:|||
  Rat   747 GCAQAKKPGVYARITRLKDWI 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 87/243 (36%)
Tryp_SPc 798..1038 CDD:238113 88/244 (36%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3252
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.