DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Tmprss3

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:257 Identity:105/257 - (40%)
Similarity:151/257 - (58%) Gaps:18/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 CGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCV-DNVPPSD 851
            ||.|....||||||..::..:||||:|| |::.   .|.||.:::...|.:|||||| |...|..
  Rat   207 CGMRTGYSPRIVGGNVSSLTQWPWQVSL-QFQG---YHLCGGSVITPLWIVTAAHCVYDLYHPKS 267

  Fly   852 LLLRLGEYDLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDN 916
            ..:::|...|.:...|    ...|:.:..|.::.|:....|:||::..||:.|...|.|:|:|::
  Rat   268 WTVQVGLVSLMDSPVP----SHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNS 328

  Fly   917 DENF-IGQTAFVTGWGRLYED--GPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGW 978
            :||| .|:..:.:|||.. ||  |....||...|||:|:|.||.......|.|.  |.: :|||:
  Rat   329 EENFPDGKLCWTSGWGAT-EDGAGDASPVLNHAAVPLISNKICNHRDVYGGIIS--PSM-LCAGY 389

  Fly   979 KKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWINQILQ 1040
            .|||.|||:||||||:|.|..  :.:.|.|..|:||||||.|:|||||||:.|.|||::.|:
  Rat   390 LKGGVDSCQGDSGGPLVCQER--RLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHEQLE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 98/241 (41%)
Tryp_SPc 798..1038 CDD:238113 99/243 (41%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 2/3 (67%)
Tryp_SPc 216..444 CDD:214473 98/241 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9079
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.